Recombinant APRIL (A proliferation-inducing ligand), Human ,AF
Source: Cytokines  Catalog No. : PY2105 
Recombinant APRIL (A proliferation-inducing ligand), Human ,AF (PY2105)
UniProt:O75888
Application:Cell culture,Elisa
Endotoxin level:<0.1 EU per 1 μg of the protein by the LAL method.
Source:Human Cytokineshttp://www.abways.com/showproduct.asp?cid=PY2105
Data Sheet
  • UniProt
  • Gene ID
    8741
  • Calculated Molecular Weight
    17.29 kDa
  • SDS-PAGE Molecular Weight(under reducing condition)
    18 kDa
  • Alternative Names
    TNFSF13, CD256, TALL-2, TALL2, TNLG7B, TRDL-1, UNQ383/PRO715, ZTNF2
  • Activity
    Measured by its ability to induce cell death in Jurkat cells. The ED50 for this effect is 2.6-4.0 μg/mL.
  • Storage
    Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei
  • Purification
    >98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag
    His-tag at the C-terminus
  • Expression Host
    Escherichia coli
  • Description
    APRIL (A PRoliferation-Inducing Ligand) is a member of the tumor necrosis factor family. APRIL shows high levels of expression in tumors of different origin and low level of expression in normal cells. APRIL shares two TNF receptor family members, TACI and BCMA (or another TNF homolog, BlyS/BAFF) have been reported to play a role in autoimmune disease and cancer. The protein encoded by this gene is a member of the tumor necrosis factor ligand (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vivo experiments suggest an important role for APRIL in the long-term survival of plasma cells in the bone marrow. Mice deficient in APRIL have normal immune system development. However, APRIL-deficient mice have also been reported to possess a reduced ability to support plasma cell survival. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
  • Formulation
    The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0.
  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Applications
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Application
    Cell culture,Elisa
  • Expression Sequence
    MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL with polyhistidine tag at the C-terminus.
  • SDS- PAGE analysis of recombinant human APRIL
Catalog No:PY2105
  • Size:5ug/20ug/100ug/500ug/1mg
  • Price:$85/210/630/1800/2800
  • Delivery:3-4 days
Order Information:
You can contact authorized dealers to purchase Abways products and obtain support. You can also contact Abways China directly