Recombinant Activin B, Human ,AF
Source: Cytokines  Catalog No. : PY2102 
Recombinant Activin B, Human ,AF (PY2102)
UniProt:P09529
Application:Cell culture,Elisa
Endotoxin level:<0.1 EU per 1 μg of the protein by the LAL method.
Source:Human Cytokineshttp://www.abways.com/showproduct.asp?cid=PY2102
Data Sheet
  • UniProt
  • Gene ID
    3625
  • Calculated Molecular Weight
    13.75 kDa
  • SDS-PAGE Molecular Weight(under reducing condition)
    17 kDa
  • Alternative Names
    Activin Beta B, INHBB; inhibin beta B chain
  • Activity
    Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <0.7 ng/mL. The specific activity of recombinant human Activin B is > 1.5 x 106 IU/mg.
  • Storage
    Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei
  • Purification
    >98% as determined by SDS-PAGE. Ni-NTA chromatography
  • Fusion tag
    His-tag at the C-terminus
  • Expression Host
    Escherichia coli
  • Description
    Activins and inhibins, members of the TGF-beta superfamily, are disulfide-linked dimeric proteins that were originally purified from gonadal fluids as proteins that stimulated or inhibited, respectively, pituitary follicle stimulating hormone (FSH) release. Activin is strongly expressed in wounded skin, and overexpression of activin in epidermis of transgenic mice improves wound healing and enhances scar formation. Activin also regulates the morphogenesis of branching organs such as the prostate, lung, and kidney. There is also evidence showed that lack of activin during development results in neural developmental defects.
  • Formulation
    The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Applications
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Application
    Cell culture,Elisa
  • Expression Sequence
    MGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus.
  • SDS- PAGE analysis of recombinant human Activin B
Catalog No:PY2102
  • Size:5ug/20ug/100ug/500ug/1mg
  • Price:$85/210/630/1800/2800
  • Delivery:3-4 days
Order Information:
You can contact authorized dealers to purchase Abways products and obtain support. You can also contact Abways China directly