Recombinant 4-1BBL (4-1BB ligand), Human ,AF
Source: Cytokines  Catalog No. : PY2101 
Recombinant 4-1BBL (4-1BB ligand), Human ,AF (PY2101)
UniProt:P41273
Application:Cell culture,Elisa
Endotoxin level:<0.1 EU per 1 μg of the protein by the LAL method.
Source:Human Cytokineshttp://www.abways.com/showproduct.asp?cid=PY2101
Data Sheet
  • UniProt
  • Gene ID
    8744
  • Calculated Molecular Weight
    20.38 kDa
  • SDS-PAGE Molecular Weight(under reducing condition)
    20 kDa
  • Alternative Names
    CD137L, TNLG5A, TNFSF9
  • Activity
    Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.7 ng/mL.
  • Storage
    Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protei
  • Purification
    >95% as determined by SDS-PAGE. Ni-NTA chromatography.
  • Fusion tag
    His-tag at the C-terminus
  • Expression Host
    Escherichia coli
  • Description
    4-1BBL is a transmembrane cytokine that is part of the tumor necrosis factor (TNF) ligand family. Recombinant human 4-1BB ligand is intended for use in cell culture applications. 4-1BBL and its interaction with 4-1BB is involved in the antigen presenting process, proliferation of CD4 and CD8 positive T-cells, as well as cytokine secretion from T-cells.
  • Formulation
    The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Applications
  • Endotoxin level
    <0.1 EU per 1 μg of the protein by the LAL method.
  • Application
    Cell culture,Elisa
  • Expression Sequence
    MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE with polyhistidine tag at the C-terminus.
  • SDS- PAGE analysis of recombinant human 4-1BBL
Catalog No:PY2101
  • Size:5ug/20ug/100ug/500ug/1mg
  • Price:$85/210/630/1800/2800
  • Delivery:3-4 days
Order Information:
You can contact authorized dealers to purchase Abways products and obtain support. You can also contact Abways China directly